General Information of Synthetic Binding Protein (SBP) (ID: SBP000102)
SBP Name
Anticalin anti-BzBuPht PhtA
Synonyms
Anticalin PhtA
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli JM83
Selection Method Phage display
Highest Status Research
SBP Sequence
>Anticalin anti-BzBuPht PhtA
NVYHDGACPEVKPVDNFDWSNYHGKWWEVAKYPKERYKYGKCGWAEYTPEGKSVKVSCYS
VIHGKEYFLEGTAYPVGDSKIGKIYHKLTLGGGTRENVFNVLSTDNKNYIIGYICFYDED
KKGHVDCVWVLSRSKVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVN
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Bilin-binding protein
Protein Scaffold Information of This SBP
Scaffold ID PS011
Scaffold Info
[1]
Scaffold Name Anticalin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Benzyl butyl phthalate
BTS Info
Binder Tools as a reagent specificity for a nonsymmetric phthalic acid ester Kd: 9100 nM Technical University of Munich [1]
References
1 Generation of anticalins with specificity for a nonsymmetric phthalic acid ester. Anal Biochem. 2002 Sep 15;308(2):269-77.