Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000089) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Anticalin anti-VEGFR-3 A5C3(F71H)
|
|||||
Synonyms |
Anticalin A5C3(F71H)
|
|||||
Molecular Weight | 20.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 178 | |||||
SBP Sequence |
>Anticalin anti-VEGFR-3 A5C3(F71H)
QDSTSDLIPAPPLSKVPLQQNFQDNQFhGKWYVVGMAGNGLLREDKDPVKMLATIYELKE DKSYNVTWVLHWRKKCYYTIRTFVPGsQPGEFTLGPIKSIPGKTSPLVRVVSTNYNQHAM VFFKTVKQNREWFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
|||||
Template Name | Lipocalin 2 (Lcn2) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS011 | [1] | ||||
Scaffold Name | Anticalin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Vascular endothelial growth factor receptor 3 | Binder | Tumors [ICD-11: XH1N44] | Kd: 0.014 nM | Technical University of Munich | [1] | |