Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000087)
SBP Name
Anticalin anti-VEGFR-3 S3A9
Synonyms
Anticalin S3A9
Molecular Weight 20.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 178
SBP Sequence
>Anticalin anti-VEGFR-3 S3A9
QDSTSDLIPAPPLSKVPLQQNFQDNQFhGKWYVVGRAGNLRLREDKDPFKMVATIYELKE
DKSYNVTYVLFRFKKCEYIIRTFVPGsQPGEFTLGTIKSPPGSTSLLVRVVSTNYNQHAM
VFFKSVKQNREWFSITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Template Name Lipocalin 2 (Lcn2)
Protein Scaffold Information of This SBP
Scaffold ID PS011
Scaffold Info
[1]
Scaffold Name Anticalin
Scaffold Class Non-Antibody
Fold Type One Alpha-Helix + Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Vascular endothelial growth factor receptor 3
BTS Info
Binder Tumors [ICD-11: XH1N44] Kd: 90.4 nM Technical University of Munich [1]
References
1 Anticalins directed against vascular endothelial growth factor receptor 3 (VEGFR-3) with picomolar affinities show potential for medical therapy and in vivo imaging. Biol Chem. 2017 Jan 1;398(1):39-55.