Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000085) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Anticalin anti-PSMA A3A5.7
|
|||||
| Synonyms |
Anticalin A3A5.7
|
|||||
| Molecular Weight | 20.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display and ELISA screening | |||||
| Highest Status | Research | |||||
| Sequence Length | 178 | |||||
| SBP Sequence |
>Anticalin anti-PSMA A3A5.7
QDSTSDLIPAPPLSKVPLQQNFQDNQFhGKWYVVGLAGNVILREDKDPYKMSATIYELKE DKSYNVTNVRFYLNKCYYTIATFVPGsRPGEFTLGTIKSGPGKTSGLVRVVSTNYSQHAM VFFKEVQQNREWFIITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
|||||
| Template Name | Lipocalin 2 (Lcn2) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS011 | [1] | ||||
| Scaffold Name | Anticalin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Glutamate carboxypeptidase 2 | Binder | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | Kd: 0.54 nM | Academy of Sciences of the Czech Republic | [1] | |