Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000078) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Anticalin anti-Hsp70 BBG10C/I
|
|||||
| Synonyms |
Anticalin BBG10C/I
|
|||||
| Molecular Weight | 20.7 kDa | |||||
| Thermal Denaturation TEMP | 65.5 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | EspP-based Escherichia coli K12 display | |||||
| Highest Status | Research | |||||
| Sequence Length | 178 | |||||
| SBP Sequence |
>Anticalin anti-Hsp70 BBG10C/I
QDSTSDLIPAPPLSKVPLQQNFQDNQFhGKWYVVGLAGNHFLWEDKDPPKMYATIYELKE DKSYNVTYVRSELKKCEYFIRTFVPGsQPGEFTLGQIKGRPDMTSVLVRVVSTNYNQHAM VFFKRVIQNREYFQITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
|||||
| Template Name | BBG10 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS011 | [1] | ||||
| Scaffold Name | Anticalin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Heat shock 70 kDa protein 1A | Binder | Tumors [ICD-11: XH1N44] | Kd: 0.51 nM | Technical University of Munich | [1] | |