Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000036) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-SHP2 NSa1
|
|||||
Synonyms |
Monobody NSa1
|
|||||
Molecular Weight | 10.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Human embryonic kidney?cells 293; K562 Cells | |||||
Selection Method | Phage display and yeast display | |||||
Highest Status | Research | |||||
PDB ID | 4JE4 | |||||
Sequence Length | 94 | |||||
SBP Sequence |
>Monobody anti-SHP2 NSa1
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGSGGYAWQEFEVPGSKSTATI SGLKPGVDYTITVYAGYYGYPTYYSSPISINYRT |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] , [2] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||