Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000035) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-SHP2 CS1
|
|||||
| Synonyms |
Monobody CS1
|
|||||
| Molecular Weight | 10.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Human embryonic kidney?cells 293; K562 Cells | |||||
| Selection Method | Phage display and yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 4JEG | |||||
| Sequence Length | 94 | |||||
| SBP Sequence |
>Monobody anti-SHP2 CS1
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYWPYYWQEFEVPGSKSTATI SGLKPGVDYTITVYAGSYDSYYYYGSPISINYRT |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] , [2] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||