Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000035)
SBP Name
Monobody anti-SHP2 CS1
Synonyms
Monobody CS1
Molecular Weight 10.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Human embryonic kidney?cells 293; K562 Cells
Selection Method Phage display and yeast display
Highest Status Research
PDB ID 4JEG
Sequence Length 94
SBP Sequence
>Monobody anti-SHP2 CS1
VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYWPYYWQEFEVPGSKSTATI
SGLKPGVDYTITVYAGSYDSYYYYGSPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Src-homology 2 domain-containing phosphatase 2
BTS Info
Inhibitor Research tool Kd: 44 nM University of Chicago [1] , [2]
References
1 Monobodies and other synthetic binding proteins for expanding protein science. Protein Sci. 2017 May;26(5):910-924.
2 Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains. Proc Natl Acad Sci U S A. 2013 Sep 10;110(37):14924-9.