Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000012)
SBP Name
Monobody anti-SUMO clone 1
Synonyms
ySMB-1
Molecular Weight 10.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
PDB ID 3QHT
Sequence Length 97
SBP Sequence
>Monobody anti-SUMO Slone 1
GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSYYRITYGETGGNSPVQEFTVPGSSSTA
TISGLSPGVDYTITVYAYYSYYDLYYSYSPSSINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Small ubiquitin-related modifier 1
BTS Info
Inhibitor Research tool Kd: 54000 nM University of Chicago [1] , [2]
Yeast small ubiquitin-related modifier
BTS Info
Inhibitor Research tool Kd: 82 nM University of Chicago [1] , [2]
References
1 A sweet protein monellin as a non-antibody scaffold for synthetic binding proteins. J Biochem. 2021 Jan 2;mvaa147.
2 Isoform-specific monobody inhibitors of small ubiquitin-related modifiers engineered using structure-guided library design. Proc Natl Acad Sci U S A. 2011 May 10;108(19):7751-6.