Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000003) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody Talditercept alfa
|
|||||
| Synonyms |
Taldefgrobep alfa; BMS-986089; RO-7239361; RO7239361; RG6206
|
|||||
| Molecular Weight | 75.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase III | |||||
| Sequence Length | 340 | |||||
| SBP Sequence |
>Monobody Talditercept alfa
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIKTISKAKG QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESAAEAQEGEL EGVSDVPRDLEVVAATPTSLLISWTLPHAGRAHYYRITYGETGGNSPVQEFTVPGRGVTA TISGLKPGVDYTITVYAVTVTTTKVIHYK PISINYRTEI |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] , [2] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Growth/differentiation factor 8 | Inhibitor | Duchenne muscular dystrophy [ICD-11: 8C70.1]; Cachexia [ICD-11: MG20.Z] | Kd: 0.17 nM | Bristol-Meyers Squibb; Roche | [1] , [2] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| EUCTR2016-001654-18-BE | Click to show the Detail | |||||
| Indication | Duchenne Muscular dystrophy | |||||
| Phase | Phase III | |||||
| Title | A randomized, double blind, placebo-controlled, study to assess the efficacy, safety, and tolerability of RO7239361 (BMS-986089) in ambulatory boys with Duchenne Muscular dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-DE | Click to show the Detail | |||||
| Indication | Duchenne Muscular dystrophy | |||||
| Phase | Phase III | |||||
| Title | A randomized, double blind, placebo-controlled, study to assess the efficacy, safety, and tolerability of RO7239361 in ambulatory boys with Duchenne Muscular dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-ES | Click to show the Detail | |||||
| Indication | Duchenne Muscular Dystrophy | |||||
| Phase | Phase III | |||||
| Title | A Randomized, Double Blind, Placebo-Controlled, Study to Assess the Efficacy, Safety, and Tolerability of BMS-986089 in Ambulatory Boys with Duchenne Muscular Dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-FR | Click to show the Detail | |||||
| Indication | Duchenne Muscular dystrophy | |||||
| Phase | Phase III | |||||
| Title | A Randomized, Double Blind, Placebo-Controlled, Study to Assess the Efficacy, Safety, and Tolerability of BMS-986089 in Ambulatory Boys with Duchenne Muscular Dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-GB | Click to show the Detail | |||||
| Indication | Duchenne Muscular dystrophy | |||||
| Phase | Phase III | |||||
| Title | A Randomized, Double Blind, Placebo-Controlled, Study to Assess the Efficacy, Safety, and Tolerability of RO7239361 in Ambulatory Boys with Duchenne Muscular Dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-IT | Click to show the Detail | |||||
| Indication | Duchenne Muscular Dystrophy | |||||
| Phase | Phase III | |||||
| Title | A Randomized, Double Blind, Placebo-Controlled, Study to Assess the Efficacy, Safety, and Tolerability of BMS-986089 in Ambulatory Boys with Duchenne Muscular Dystrophy | |||||
| Status | Authorised | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-NL | Click to show the Detail | |||||
| Indication | Duchenne Muscular Dystrophy | |||||
| Phase | Phase III | |||||
| Title | A Randomized, Double Blind, Placebo-Controlled, Study to Assess the Efficacy, Safety, and Tolerability of RO7239361 in Ambulatory Boys with Duchenne Muscular Dystrophy | |||||
| Status | Authorised | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| EUCTR2016-001654-18-SE | Click to show the Detail | |||||
| Indication | Duchenne Muscular dystrophy | |||||
| Phase | Phase III | |||||
| Title | A randomized, double blind, placebo-controlled, study to assess the efficacy, safety, and tolerability of RO7239361 in ambulatory boys with Duchenne Muscular dystrophy | |||||
| Status | Not Recruiting | |||||
| Sponsor | F. Hoffmann-La Roche Ltd | |||||
| NCT02145234 | Click to show the Detail | |||||
| Indication | Healthy | |||||
| Phase | Phase I | |||||
| Title | A Randomized, Placebo-Controlled, Single and Multiple Ascending Subcutaneous Dose Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Pharmacodynamics of BMS-986089 in Healthy Adult Subjects | |||||
| Status | Completed | |||||
| Sponsor | Hoffmann-La Roche | |||||
| NCT02515669 | Click to show the Detail | |||||
| Indication | Duchenne Muscular Dystrophy | |||||
| Phase | Phase I; Phase II | |||||
| Title | A Multi-Site, Randomized, Placebo-Controlled, Double-Blind, Multiple Ascending Subcutaneous Dose Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of RO7239361 (BMS-986089) in Ambulatory Boys With Duchenne Muscular Dystrophy | |||||
| Status | Terminated | |||||
| Sponsor | Hoffmann-La Roche | |||||
| NCT03039686 | Click to show the Detail | |||||
| Indication | Duchenne Muscular Dystrophy | |||||
| Phase | Phase II; Phase III | |||||
| Title | Clinical Trial to Evaluate the Efficacy, Safety, and Tolerability of RO7239361 in Ambulatory Boys With Duchenne Muscular Dystrophy | |||||
| Status | Completed | |||||
| Sponsor | Hoffmann-La Roche | |||||
| NCT05337553 | Click to show the Detail | |||||
| Indication | Spinal Muscular Atrophy; Neuromuscular Diseases; SMA | |||||
| Phase | Phase III | |||||
| Title | A Study to Evaluate the Efficacy and Safety of Taldefgrobep Alfa in Participants With Spinal Muscular Atrophy | |||||
| Status | Active, not recruiting | |||||
| Sponsor | Biohaven Pharmaceuticals, Inc. | |||||