General Information of Binding Target of SBP (BTS) (ID: ST00592)
BTS Name
Vacuolar protein sorting-associated protein 29
Synonyms
hVPS29; PEP11 homolog; Vesicle protein sorting 29
BTS Type
Protein
Family
VPS29 family
Gene Name
VPS29
Organism
Homo sapiens (Human)
Function
Acts as a component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).; Acts also as component of the retriever complex. The retriever complex is a heterotrimeric complex related to retromer cargo-selective complex (CSC) and essential for retromer-independent retrieval and recycling of numerous cargos such as integrin alpha-5/beta-1 (ITGA5:ITGB1).; In the endosomes, retriever complex drives the retrieval and recycling of NxxY-motif-containing cargo proteins by coupling to SNX17, a cargo essential for the homeostatic maintenance of numerous cell surface proteins associated with processes that include cell migration, cell adhesion, nutrient supply and cell signaling.; The recruitment of the retriever complex to the endosomal membrane involves CCC and WASH complexes.; Involved in GLUT1 endosome-to-plasma membrane trafficking; the function is dependent of association with ANKRD27.; (Microbial infection) The heterotrimeric retromer cargo-selective complex (CSC) mediates the exit of human papillomavirus from the early endosome and the delivery to the Golgi apparatus.
UniProt ID
Q9UBQ0
UniProt Entry
VPS29_HUMAN
PFam
PF12850
Gene ID
51699
Sequence
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR
GDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFE
AFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYK
KP
Sequence Length
182
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Macrocyclic peptide anti-retromer RT-D1 Research Inhibitor Kd: 95 nM Tool for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex
SBP Info
[1]
Macrocyclic peptide anti-retromer RT-D2 Research Inhibitor Kd: 64 nM Tool for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex
SBP Info
[1]
Macrocyclic peptide anti-retromer RT-D3 Research Inhibitor Kd: 9 nM Tool for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex
SBP Info
[1]
Macrocyclic peptide anti-retromer RT-L1 Research Inhibitor Kd: 64 nM Tool for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex
SBP Info
[1]
Macrocyclic peptide anti-retromer RT-L2 Research Inhibitor Kd: 784 nM Tool for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex
SBP Info
[1]
References
1 De novo macrocyclic peptides for inhibiting, stabilizing, and probing the function of the retromer endosomal trafficking complex. Sci Adv. 2021 Dec 3;7(49):eabg4007.