Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00324) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Alpha-synuclein
|
|||||
| Synonyms |
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Synuclein family
|
|||||
| Gene Name |
SNCA
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 This chaperone activity is important to sustain normal SNARE-complex assembly during aging Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA |
|||||
| Sequence Length |
140
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-alpha-syn 10H | Research | Binder | N.A. | Parkinson disease [ICD-11: 8A00.0] | [1] | |
| scFv anti-alpha-syn D10 | Research | Binder | N.A. | Parkinson disease [ICD-11: 8A00.0] | [1], [2] | |
| scFv anti-alpha-syn D5E | Research | Binder | N.A. | Parkinson disease [ICD-11: 8A00.0] | [1] | |
| References |
|---|