Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00274) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Insulin
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Insulin family
|
|||||
| Gene Name |
INS
|
|||||
| Organism |
Bos taurus (Bovine)
|
|||||
| Function |
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN |
|||||
| Sequence Length |
105
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-Insulin PDR5A3(3) | Research | Binder | Kd: 11.8 nM | Research tool | [1] | |
| scFv anti-Insulin PDR5C4(3) | Research | Binder | Kd: 18 nM | Research tool | [1] | |
| scFv anti-Insulin PSEP010(1)H7 | Research | Binder | Kd: 0.15 nM | Research tool | [1] | |
| scFv anti-Insulin PSEP010(2)F5 | Research | Binder | Kd: 0.25 nM | Research tool | [1] | |
| scFv anti-Insulin PSEP010(3)B6 | Research | Binder | Kd: 0.23 nM | Research tool | [1] | |
| scFv anti-Insulin PSEP010(3)D10 | Research | Binder | Kd: 0.28 nM | Research tool | [1] | |
| scFv anti-Insulin RD012A8(2) | Research | Binder | Kd: 0.56 nM | Research tool | [1] | |
| scFv anti-Insulin RD012D5(3) | Research | Binder | Kd: 5.7 nM | Research tool | [1] | |
| scFv anti-Insulin RD012H10(3) | Research | Binder | Kd: 0.19 nM | Research tool | [1] | |
| scFv anti-Insulin RD0134A4(3) | Research | Binder | Kd: 1.21 nM | Research tool | [1] | |