Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00264) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Interleukin-33
|
|||||
Synonyms |
IL-33; Interleukin-1 family member 11; IL-1F11; Nuclear factor from high endothelial venules; NF-HEV
|
|||||
BTS Type |
Protein
|
|||||
Family |
IL-1 family
|
|||||
Gene Name |
IL33
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury ; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets This form is rapidely lost upon angiogenic or proinflammatory activation
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI GVKDNHLALIKVDSSENLCTENILFKLSET |
|||||
Sequence Length |
270
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
scFv anti-IL-33 A-1 | Research | Inhibitor | Kd: 12.1 nM | Inflammation [ICD-11: 1A00-CA43.1]; Allergy [ICD-11: 4A80-4A85] | [1] | |
scFv anti-IL-33 A-2 | Research | Inhibitor | Kd: 11.4 nM | Inflammation [ICD-11: 1A00-CA43.1]; Allergy [ICD-11: 4A80-4A85] | [1] | |
scFv anti-IL-33 A-3 | Research | Inhibitor | Kd: 12.3 nM | Inflammation [ICD-11: 1A00-CA43.1]; Allergy [ICD-11: 4A80-4A85] | [1] | |
scFv anti-IL-33 A-4 | Research | Inhibitor | Kd: 83.5 nM | Inflammation [ICD-11: 1A00-CA43.1]; Allergy [ICD-11: 4A80-4A85] | [1] | |
scFv anti-IL-33 A-5 | Research | Inhibitor | Kd: 41.5 nM | Inflammation [ICD-11: 1A00-CA43.1]; Allergy [ICD-11: 4A80-4A85] | [1] | |