Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00242) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
SsrA-binding protein
|
|||||
| Synonyms |
Small protein B
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
SmpB family
|
|||||
| Gene Name |
smpB
|
|||||
| Organism |
Aeromonas veronii
|
|||||
| Function |
Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MSKKNSKNKAGSSTIALNRTARHEYFIEEKIEAGLSLQGWEVKSLRAGKANISEAYVIFR
DGEAYLFGSSFLPLQAASSHVVCDPTRTRKLLLSRRELDKLESLIARQGYTIVPLALYWK QCWVKVEIGLVKGKKEHDKREDTKAREWDREKARIMKNKHRG |
|||||
| Sequence Length |
162
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Peptide aptamer anti-SmpB clone 1 | Research | Inhibitor | Kd: 691 nM | Aeromonas veronii infection | [1] | |