Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00233) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Replication-associated protein
|
|||||
| Synonyms |
Rep; EC 2.7.7.-; EC 3.1.21.-; Protein AC1; Protein AL1
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Geminiviridae Rep protein family
|
|||||
| Organism |
Tomato golden mosaic virus (strain Yellow vein) (TGMV)
|
|||||
| Function |
Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MPSHPKRFQINAKNYFLTYPQCSLSKEESLSQLQALNTPINKKFIKICRELHEDGQPHLH
VLIQFEGKYCCQNQRFFDLVSPTRSAHFHPNIQRAKSSSDVKTYIDKDGDTLVWGEFQVD GRSARGGCQTSNDAAAEALNASSKEEALQIIREKIPEKYLFQFHNLNSNLDRIFDKTPEP WLPPFHVSSFTNVPDEMRQWAENYFGKSSAARPERPISIIIEGDSRTGKTMWARSLGPHN YLSGHLDLNSRVYSNKVEYNVIDDVTPQYLKLKHWKELIGAQRDWQTNCKYGKPVQIKGG IPSIVLCNPGEGASYKVFLDKEENTPLKNWTFHNAKFVFLNSPLYQSSTQSS |
|||||
| Sequence Length |
352
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Peptide aptamer anti-Rep A22 | Research | Binder | N.A. | Tomato yellow leaf curl virus infection; Tomato mottle virus infection | [1] | |
| Peptide aptamer anti-Rep A64 | Research | Binder | N.A. | Tomato yellow leaf curl virus infection; Tomato mottle virus infection | [1] | |