Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00176) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Vascular endothelial growth factor A
|
|||||
Synonyms |
VEGF-A; Vascular permeability factor; VPF
|
|||||
BTS Type |
Protein
|
|||||
Family |
PDGF/VEGF growth factor family
|
|||||
Gene Name |
Vegfa
|
|||||
Organism |
Mus musculus (Mouse)
|
|||||
Function |
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity). Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
|||||
Sequence Length |
214
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Fab anti-VEGF YADS1 | Research | Binder | Kd: >1000 nM | Research tool | [1] | |
Fab anti-VEGF YADS2 | Research | Binder | Kd: 5 nM | Research tool | [1] | |
Fab anti-VEGF YADS3 | Research | Binder | Kd: 3.7 nM | Research tool | [1] | |