Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00160) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Fc-gamma receptor IIIb
|
|||||
| Synonyms |
CD16; Fragment
|
|||||
| BTS Type |
Protein
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
DLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATV
NDSGEYRCQTNLSTLSDPVQLEVHI |
|||||
| Sequence Length |
85
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Diabody anti-ERBB1/CD16 hEx16-3G/5 | Research | Activator | Kd: 528 nM | Research tool | [1] | |
| Diabody anti-ERBB1/CD16 hEx16-5/3G | Research | Activator | Kd: 306000 nM | Research tool | [1] | |
| Diabody anti-ERBB1/CD16 hEx16-HL | Research | Activator | Kd: 591 nM | Research tool | [1] | |
| Diabody anti-ERBB1/CD16 hEx16-LH | Research | Activator | Kd: 532 nM | Research tool | [1] | |