Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00159) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Fibroblast growth factor 2
|
|||||
| Synonyms |
FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Heparin-binding growth factors family
|
|||||
| Gene Name |
Fgf2
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Also acts as an integrin ligand which is required for FGF2 signaling (By similarity). Binds to integrin ITGAV:ITGB3 (By similarity). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (By similarity). Functions as a potent mitogen in vitro (By similarity). Can induce angiogenesis (By similarity). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
|||||
| Sequence Length |
154
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Diabody anti-FGF2 | Research | Inhibitor | N.A. | Lung cancer [ICD-11: 2C25.Z]; Breast cancer [ICD-11: 2C6Z] | [1], [2], [3] | |
| References |
|---|