Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00151) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
26S proteasome complex subunit SEM1
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
DSS1/SEM1 family
|
|||||
| Gene Name |
SEM1
|
|||||
| Organism |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
|
|||||
| Function |
Versatile protein that might stabilize multiple protein complexes involved in diverse pathways. Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis. Associates also with the TREX-2 complex that is required for transcription-coupled mRNA export, and the COP9 signalosome, which is involved in deneddylation.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIW
EENWDDVEVDDDFTNELKAELDRYKRENQ |
|||||
| Sequence Length |
89
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Designed TPR protein anti-Dss1 T-Mods | Research | Inhibitor | Kd: 175000 nM | Cancers [ICD-11: 2D4Z] | [1] | |