Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00092) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Myeloid cell surface antigen CD33
|
|||||
| Synonyms |
Sialic acid-binding Ig-like lectin 3; Siglec-3; gp67; CD antigen CD33
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Immunoglobulin superfamily;
SIGLEC (sialic acid binding Ig-like lectin) family |
|||||
| Gene Name |
CD33
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE VRTQ |
|||||
| Sequence Length |
364
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| BiTE AMG-673 | Phase I; Suspended | Inhibitor | N.A. | Acute myeloid leukaemia [ICD-11: XH8AA5] | [1] | |
| BiTE Eluvixtamab | Phase I | Inhibitor | N.A. | Acute myeloid leukaemia [ICD-11: XH8AA5] | [2], [1] | |
| scFv Emerfetamab | Phase I | Binder | N.A. | Acute myeloid leukaemia [ICD-11: XH8AA5] | [3] | |