Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000002)
SBP Name
Monobody BMS-962476
Synonyms
PCSK9-binding Adnectin BMS-962476; BMS962476; BMS 962476
Molecular Weight 11.3 kDa
Thermal Denaturation TEMP 81 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method mRNA display
Highest Status Phase I
Sequence Length 103
SBP Sequence
>Monobody BMS-962476
GVSDVPRDLEVVAATPTSLLISWVPPSDDYGYYRITYGETGGNSPVQEFTVPIGKGTATI
SGLKPGVDYTITVYAVEFPWPHAGYYHRPISINYRTEIEKPCQ
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Adnectin 1459D05
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Proprotein convertase subtilisin/kexin type 9
BTS Info
Inhibitor Hypercholesterolaemia [ICD-11: 5C80.0] Kd: 0.85 nM Adnexus; Bristol-Meyers Squibb [1] , [2]
Clinical Trial Information of This SBP
NCT01587365 Click to show the Detail
Indication Hypercholesterolemia
Phase Phase I
Title Randomized, Double-Blind, Placebo-Controlled, Ascending Single-Dose Study to Evaluate the Safety, Pharmacokinetics and Pharmacodynamics of BMS-962476 in Healthy Subjects and in Patients With Hypercholesterolemia on Statin Therapy
Status Completed
Sponsor Bristol-Myers Squibb
References
1 In vitro-engineered non-antibody protein therapeutics. Protein Cell. 2018 Jan;9(1):3-14.
2 Pharmacologic profile of the Adnectin BMS-962476, a small protein biologic alternative to PCSK9 antibodies for low-density lipoprotein lowering. J Pharmacol Exp Ther. 2014 Aug;350(2):412-24.