Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003596) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-CDK4 AK2
|
|||||
| Synonyms |
scFv AK2
|
|||||
| Molecular Weight | 24.1 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 228 | |||||
| SBP Sequence |
>VH
TQVQLQESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTY YADSVEGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARRLTGFDYWGQGTLVTVSS >VL QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGV SNRFSGSKSGNTASLTIFGLQAEDEADYYCSSYTSSSTLVFGGGTKLTVLG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Cyclin-dependent kinase 4 | Inhibitor | Diagnostic reagent | Kd: 248 nM | Jilin University | [1] | |