Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003553) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-E2 glycoprotein UNbC5-1
|
|||||
Synonyms |
Nanobody UNbC5-1
|
|||||
Molecular Weight | 13.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 127 | |||||
SBP Sequence |
>Nanobody anti-E2 glycoprotein UNbC5-1
EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYAIGWFRQAPGKEREGVSCISTSDGSTYY ADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYYCAADPYLPIRGRGIESTDFGSWGQG TQVTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Complement C5 | Inhibitor | Tools as diagnostic and/or research tools to detect C5 or inhibit C5 cleavage | Kd: 0.1199 nM | Utrecht University | [1] | |