Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003547) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-Abeta42 scFv-C
|
|||||
| Synonyms |
scFv C
|
|||||
| Molecular Weight | 26.6 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Research | |||||
| Sequence Length | 258 | |||||
| SBP Sequence |
>scFv anti-Abeta42 scFv-C
DIVMTQSPLSLPVTPGEPASISCRSSQSLVYSNGDTYLHWYLQKPGQSPQLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPWTFGQGTKVEIGGGGSGGGG SGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLELVASINSN GGSTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCASGDYWGQGTTVTVSGGG GSGGGGSGGGGSHHHHHH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Amyloid-beta precursor protein | Inhibitor | Alzheimers disease (AD) [ICD-11: 8A20] | Kd: 2.0 nM | Jilin University | [1] | |