Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003527) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-IgG1-Fc FCM101
|
|||||
| Synonyms |
Monobody FCM101
|
|||||
| Molecular Weight | 13.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | phage display; yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 124 | |||||
| SBP Sequence |
>Monobody anti-IgG1-Fc FCM101
MKHHHHHHHSSDYKDDDDKGENLYFQGSVSSVPTKLEVVAATPTSLLISWDAPAVTVYYY VITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAGYGSGGYYSPISINYRTE IDKC |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Ig gamma-1 chain C region secreted form | Binder | Tools as a plug-and-play adapter between NPs and targeting Abs. | Kd: 4.2 nM | Yale University | [1] | |