Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003509) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Scfv anti-HER2 4D5-S-ABD
|
|||||
| Synonyms |
Scfv 4D5-S-ABD
|
|||||
| Molecular Weight | 32.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| Sequence Length | 298 | |||||
| SBP Sequence |
>Scfv anti-HER2 4D5-S-ABD
MGEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTV SSGGGGSGTSLAEAKVLANRELDKYGVSDFYKRLINKAKTVEGVEALKLHILAALPTSGS GGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLY SGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKHHHHHH |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | binder | Tools for prolonging scfv Serum Half-Life | EC50: 1.95 nM | Gwangju Institute of Science and Technology | [1] | |