Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003484) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
IGF1R minibinder
|
|||||
| Synonyms |
IGF1R_mb
|
|||||
| Molecular Weight | 6.9 kDa | |||||
| Thermal Denaturation TEMP | > 95.0 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 61 | |||||
| SBP Sequence |
>IGF1R minibinder
STRNAEFIMLLLELCVKSKNDPQVQEYVKKVKKQVERLVGNGDEKKAEEVARKALEYCAD G |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Insulin-like growth factor 1 receptor | binder | Research tool | Kd: 860 nM | University of Washington | [1] | |