Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003484) | ||||||
---|---|---|---|---|---|---|
SBP Name |
IGF1R minibinder
|
|||||
Synonyms |
IGF1R_mb
|
|||||
Molecular Weight | 6.9 kDa | |||||
Thermal Denaturation TEMP | > 95.0 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 61 | |||||
SBP Sequence |
>IGF1R minibinder
STRNAEFIMLLLELCVKSKNDPQVQEYVKKVKKQVERLVGNGDEKKAEEVARKALEYCAD G |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Insulin-like growth factor 1 receptor | binder | Research tool | Kd: 860 nM | University of Washington | [1] | |