Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003480) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
EGFRn minibinder
|
|||||
| Synonyms |
EGFRn_mb
|
|||||
| Molecular Weight | 7.6 kDa | |||||
| Thermal Denaturation TEMP | > 95.0 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| Sequence Length | 62 | |||||
| SBP Sequence |
>EGFRn minibinder
DHWEEVFRWALEHLQEATQQNDPQKAKKILEEAHKWLRRELSEEEARAVVRWLKQLVDRE LS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Epidermal growth factor receptor | inhibitor | Tools for inhibiting EGF-induced ERK and AKT phosphorylation | Kd: 1.2 nM | University of Washington | [1] | |