Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003479) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
FGFR2 minibinder
|
|||||
| Synonyms |
FGFR2_mb
|
|||||
| Molecular Weight | 7.3 kDa | |||||
| Thermal Denaturation TEMP | 71.1 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 7N1K | |||||
| Sequence Length | 61 | |||||
| SBP Sequence |
>FGFR2 minibinder
DRRKEMDKVYRTAFKRITSTPDKEKRKEVVKEATEQLRRIAKDEEEKKKAAYMILFLKTL G |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fibroblast growth factor receptor 2 | inhibitor | Tools for inhibiting FGF-induced ERK phosphorylation | Kd: 243 nM | University of Washington | [1] | |