Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003460) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-Fab
|
|||||
Synonyms |
Nanobody anti-Fab
|
|||||
Molecular Weight | 13.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 | |||||
Highest Status | Research | |||||
PDB ID | 6WW2; 7JHG; 7PHP; 7PIJ | |||||
Sequence Length | 121 | |||||
SBP Sequence |
>Nanobody anti-Fab
QVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRSGDGAFY ADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQGTQVTVS S |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] , [2] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||