Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003410) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-BC2T clone BC2-R106S
|
|||||
| Synonyms |
Nb BC2-R106S
|
|||||
| Molecular Weight | 13.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Research | |||||
| Sequence Length | 125 | |||||
| SBP Sequence |
>Nanobody anti-BC2T clone BC2-R106S
QVQLVESGGGLVQPGGSLTLSCTASGFTLDHYDIGWFRQAPGKEREGVSCINNSDDDTYY ADSVKGRFTIFMNNAKDTVYLQMNSLKPEDTAIYYCAEARGCKRGSYEYDFWGQGTQVTV SSKKK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Nb BC2 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Catenin beta-1 | Binder | Research tool | Kd: 9.7 nM | Eberhard-Karls University Tuebingen | [1] | |