Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003378) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv Gancotamab
|
|||||
| Synonyms |
MM-302; MM 302
|
|||||
| Molecular Weight | 24.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase II; Discontinued | |||||
| SBP Sequence |
>scFv Gancotamab
QVQLVESGGGLVQPGGSLRLSCAASGFTFRSYAMSWVRQAPGKGLEWVSAISGRGDNTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKMTSNAFAFDYWGQGTLVTVSSG GGGSGGGGSGPPSVSGAPGQRVTISCTGSSSNIGAGYGVHWYQQLPGTAPKLLIYGNTNR PSGVPDRFSGFKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTKLTVLGGSGG C |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Receptor tyrosine-protein kinase erbB-2 | Binder | Breast cancer [ICD-11: 2C6Z] | N.A. | Merrimack Pharmaceuticals, Inc; University of California | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT01304797 | Click to show the Detail | |||||
| Indication | Breast Cancer | |||||
| Phase | Phase I | |||||
| Title | Safety and Pharmacokinetic Study of MM-302 in Patients With Advanced Breast Cancer | |||||
| Status | Unknown | |||||
| Sponsor | Merrimack Pharmaceuticals | |||||
| NCT02213744 | Click to show the Detail | |||||
| Indication | Breast Cancer; HER2 Positive Breast Cancer | |||||
| Phase | Phase II; Phase III | |||||
| Title | MM-302 Plus Trastuzumab vs. Chemotherapy of Physician's Choice Plus Trastuzumab in HER2-Positive Locally Advanced/Metastatic Breast Cancer Patients | |||||
| Status | Terminated | |||||
| Sponsor | Merrimack Pharmaceuticals | |||||
| NCT02735798 | Click to show the Detail | |||||
| Indication | Brain Metastases; Documented Her2 Overexpression; Advanced Solid Tumor; Neurologically Stable | |||||
| Phase | Phase I | |||||
| Title | 64-Cu Labeled Brain PET/MRI for MM-302 in Advanced HER2+ Cancers With Brain Mets | |||||
| Status | Withdrawn | |||||
| Sponsor | Pamela Munster | |||||