Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003375) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv Efungumab
|
|||||
| Synonyms |
hsp90 grAB; Mycograb
|
|||||
| Molecular Weight | 26.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase III | |||||
| Sequence Length | 250 | |||||
| SBP Sequence |
>scFv Efungumab
MAEVQLVESGAEVKKPGESLRISCKGSGCIISSYWISWVRQMPGKGLEWMGKIDPGDSYI NYSPSFQGHVTISADKSINTAYLQWNSLKASDTAMYYCARGGRDFGDSFDYWGQGTLVTV SSGGGGSGGGGSGGGGSDVVMTQSPSFLSAFVGDRITITCRASSGISRYLAWYQQAPGKA PKLLIYAASTLQTGVPSRFSGSGSGTEFTLTINSLQPEDFATYYCQHLNSYPLTFGGGTK VDIKRAAALE |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Heat shock protein HSP 90-beta | Inhibitor | Cryptococcal Meningitis [ICD-11: 1D01.10]; Breast cancer [ICD-11: 2C6Z] | N.A. | University of South Alabama; NeuTec Pharma | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT00217815 | Click to show the Detail | |||||
| Indication | Cancer of the Breast | |||||
| Phase | Phase I; Phase II | |||||
| Title | Preliminary Study of Mycograb and Docetaxel in Advanced Breast Cancer | |||||
| Status | Completed | |||||
| Sponsor | NeuTec Pharma | |||||
| NCT00324025 | Click to show the Detail | |||||
| Indication | Cryptococcal Meningitis | |||||
| Phase | Phase II | |||||
| Title | Efficacy and Safety of Mycograb as Adjunctive Therapy for Cryptococcal Meningitis in Patients With AIDS | |||||
| Status | Terminated | |||||
| Sponsor | Novartis Pharmaceuticals | |||||
| NCT00847678 | Click to show the Detail | |||||
| Indication | Cryptococcal Meningitis | |||||
| Phase | Phase II | |||||
| Title | Efficacy and Safety of Mycograb as Adjunctive Therapy for Cryptococcal Meningitis in Patients With AIDS | |||||
| Status | Terminated | |||||
| Sponsor | Novartis Pharmaceuticals | |||||