Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003373) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab Clervonafusp alfa
|
|||||
| Synonyms |
VAL-1221
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Highest Status | Phase II | |||||
| SBP Sequence |
>VH Chain
EVQLQESGGGVVQPGGSLRLSCAASGFTFSNYGMHWIRQAPGKGLEWVSYISSGSSTIYY ADSVKGRFTISRDNSKNTLYLQMNSLRSEDTAVYYCARRGLLLDYWGQGTLVTVSS >VL Chain DIQMTQSPSSLSASVGDRVTISCRASKSVSTSSYSYMHWYQQKPEKALIKYASYLQSGVP SRFSGSGSGTDFTLTISSLQPEDVATYYCQHSRETFGAGTKLELK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| SLC29A2 protein | Binder | Glycogen storage disease type II [ICD-11: 5C51.3] | N.A. | Istituto di Biostrutture e Bioimmagini; Valerion Therapeutics | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT02898753 | Click to show the Detail | |||||
| Indication | Late-Onset GSD-II (Pompe Disease) | |||||
| Phase | Phase I; Phase II | |||||
| Title | A Three-Month, Open-Label, Randomized, Dose-escalation Study of the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics and Preliminary Efficacy of VAL-1221 Versus Myozyme?/Lumizyme? in Patients With Late-Onset GSD-II (Pompe Disease) Followed by Open-Label Treatment With VAL-1221 in All Patients | |||||
| Status | Terminated (Company closure due to lack of funding) | |||||
| Sponsor | Valerion Therapeutics, LLC | |||||