Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003369) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Fab Alacizumab
|
|||||
| Synonyms |
Alacizumab pegol; CDP-791
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase II | |||||
| SBP Sequence |
>VH Chain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVATITSGGSYTYY VDSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCVRIGEDALDYWGQGTLVTVSS >VL Chain DIQMTQSPSSLSASVGDRVTITCRASQDIAGSLNWLQQKPGKAIKRLIYATSSLDSGVPK RFSGSRSGSDYTLTISSLQPEDFATYYCLQYGSFPPTFGQGTKVEIK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS034 | [1] | ||||
| Scaffold Name | Fab | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Vascular endothelial growth factor receptor 2 | Antagonist | Non-small cell lung cancer [ICD-11: 2C25.Y] | N.A. | UCB Pharma | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT00152477 | Click to show the Detail | |||||
| Indication | Locally Advanced or Metastatic Non-Squamous Non-Small-Cell Lung Cancer | |||||
| Phase | Phase II | |||||
| Title | A Two-Part, Open Label Phase II Trial: Part One, Dose Escalation Safety; Part Two, Randomized/Comparing CDP791 Plus Carboplatin/Paclitaxel With Carboplatin/Paclitaxel Alone in Subjects With Locally Advanced or Metastatic Non-Squamous Non-Small-Cell Lung Cancer | |||||
| Status | Completed | |||||
| Sponsor | UCB Pharma | |||||