Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003367) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-CyaA-Hly clone 37
|
|||||
| Synonyms |
VHH37
|
|||||
| Molecular Weight | 13.7 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 127 | |||||
| SBP Sequence |
>Nanobody anti-CyaA-Hly clone 37
VQLVESGGGSVQAGGSLRLSCTASGFTFDDFDMGWYHQAPGNECELVSTISNAGHTYYAD SVKGRFAISRDNAKNMVYLQMNNLKPEDTAMYYCAAVGALLGFPLVLARPRGGYNYWGQG TMVTVSS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Bifunctional hemolysin/adenylate cyclase | Inhibitor | Research tool | N.A. | Mahidol University | [1] | |