General Information of Synthetic Binding Protein (SBP) (ID: SBP003365)
SBP Name
Nanobody anti-CyaA-Hly VH5
Synonyms
Nanobody VH5
Molecular Weight 12.7 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 117
SBP Sequence
>Nanobody anti-CyaA-Hly VH5
VQLVESGGDLVQFGGSLRLSCAASAFTFSTYYMTWVRQPPGKGLEWVSGINSDGSTYYRD
SVKGRFTISRDNAKNMLYLEMISLKPEDTAVYYCAGGAGNAWLFGDWGQGTMVTVSS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Bifunctional hemolysin/adenylate cyclase
BTS Info
Binder Research tool N.A. Mahidol University [1]
References
1 Structural Characterization of Humanized Nanobodies with Neutralizing Activity against the Bordetella pertussis CyaA-Hemolysin: Implications for a Potential Epitope of Toxin-Protective Antigen. Toxins (Basel). 2016 Apr 1;8(4):99.