General Information of Synthetic Binding Protein (SBP) (ID: SBP003363)
SBP Name
Nanobody anti-Survivin R7-E
Synonyms
Nanobody R7-E
Molecular Weight 13.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Brevibacillus pBIC4
Selection Method cDNA display
Highest Status Research
SBP Sequence
>Nanobody anti-Survivin R7-E
MGEVQLVESGGGSVQAGGSLRLSCAASGVSNTDMIMIWFRQAPGKEREGVLAAIYKNSTY
YADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAIYYCAAISAVIGRHIRPHIYWGQGTQV
TVGGGS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Baculoviral IAP repeat-containing protein 5
BTS Info
Binder Research tool N.A. Saitama University [1]
References
1 Anti-survivin single-domain antibodies derived from an artificial library including three synthetic random regions by in vitro selection using cDNA display. Biochem Biophys Res Commun. 2018 Sep 10;503(3):2054-2060.