General Information of Synthetic Binding Protein (SBP) (ID: SBP003354)
SBP Name
Nanobody anti-Cry1Ac P24
Synonyms
Nanobody P24
Molecular Weight 12.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli Rosetta
Selection Method Phage display
Highest Status Research
SBP Sequence
>Nanobody anti-Cry1Ac P24
QLQLVESGGGLVQAGGSLRLSCAASGSTLSIHSFGWYRQAPGKQREAVATITNGGAPTYT
DSVKGRFNIFRDYRENTAYLQMNTLKPEDTAVYYCRVLFGVDGRAWGQGTQVTISS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Pesticidal crystal protein Cry1Ac
BTS Info
Binder Research tool N.A. Nanchang University [1]
References
1 Phage-Mediated Immuno-PCR for Ultrasensitive Detection of Cry1Ac Protein Based on Nanobody. J Agric Food Chem. 2016 Oct 19;64(41):7882-7889.