General Information of Synthetic Binding Protein (SBP) (ID: SBP003333)
SBP Name
Nanobody anti-GP EBOV-GP-E7
Synonyms
Nanobody EBOV-GP-E7
Molecular Weight 13.4 kDa
Thermal Denaturation TEMP 54 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
SBP Sequence
>Nanobody anti-GP EBOV-GP-E7
EVQLQASGGGLVQPRGSLRLSCAASGSIFSINAMGWYRQTPEKQRELVATISSSGSTKYG
DSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTQTAGLVADWGTSHYDYWGQGVQV
TVS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Envelope glycoprotein
BTS Info
Binder Research tool Kd: 34 nM Center for Bio/Molecular Science and Engineering [1]
References
1 Selection, characterization, and thermal stabilization of llama single domain antibodies towards Ebola virus glycoprotein. Microb Cell Fact. 2017 Dec 12;16(1):223.