Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003331) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-GP EBOV-GP-G6
|
|||||
Synonyms |
Nanobody EBOV-GP-G6
|
|||||
Molecular Weight | 13.4 kDa | |||||
Thermal Denaturation TEMP | 67 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
SBP Sequence |
>Nanobody anti-GP EBOV-GP-G6
DVQLQASGGGLVQAGGSLRISCAASGGALSDYNMGWFRQAPGKEREFVAVVTWSGGSTRY ADSVNGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAPLTPFQSLGDMKAYNYWGQGT QVTVS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Envelope glycoprotein | Binder | Research tool | Kd: 2 nM | Center for Bio/Molecular Science and Engineering | [1] | |