Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP003193)
SBP Name
Monobody anti-Abl HA4
Synonyms
Monobody HA4
Molecular Weight 10.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
PDB ID 3K2M
Sequence Length 101
SBP Sequence
>Monobody anti-Abl HA4
GSSVSSVPTKLEVVAATPTSLLISWDAPMSSSSVYYYRITYGETGGNSPVQEFTVPYSSS
TATISGLSPGVDYTITVYAWGEDSAGYMFMYSPISINYRTC
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2] , [3]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Tyrosine-protein kinase ABL1
BTS Info
Inhibitor Research tool Kd: 7 nM Princeton University; University of Chicago [1] , [2] , [3]
References
1 Development of light-responsive protein binding in the monobody non-immunoglobulin scaffold. Nat Commun. 2020 Aug 13;11(1):4045.
2 A potent and highly specific FN3 monobody inhibitor of the Abl SH2 domain. Nat Struct Mol Biol. 2010 Apr;17(4):519-27.
3 Monobodies as possible next-generation protein therapeutics - a perspective. Swiss Med Wkly. 2017 Nov 20;147:w14545.