Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003191) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Nanobody anti-GSN clone 11
|
|||||
Synonyms |
Nb11
|
|||||
Molecular Weight | 13.7 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Southern screening | |||||
Highest Status | Research | |||||
PDB ID | 4S10; 4S11 | |||||
Sequence Length | 127 | |||||
SBP Sequence |
>Nanobody anti-GSN clone 11
QVQLQESGGGLVQAGGSLRLSCAASGRTFSSFVMGWFRQAPGKEREFVASISRSGSVTRY ADSAKGRFTISKDNAKNTVSLQMDNLNPDDTAVYYCAADLHRPYGPGSQRTDDYDTWGQG TQVTVSS |
|||||
3D Structure |
|
|||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS048 | [1] | ||||
Scaffold Name | Nanobody | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Gelsolin | Binder | Hereditary gelsolin amyloidosis | N.A. | Faculty of Medicine and Health Sciences | [1] | |