Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003129) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody Caplacizumab
|
|||||
| Synonyms |
ALX-0081; ALX-0681; Cablivi
|
|||||
| Molecular Weight | 27.9 kDa | |||||
| Thermal Denaturation TEMP | 61 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Marketed | |||||
| PDB ID | 7EOW; 7A6O | |||||
| Sequence Length | 259 | |||||
| SBP Sequence |
>Nanobody Caplacizumab
EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYY PDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQ GTQVTVSSAAAEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVA AISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVR TLPSEYTFWGQGTQVTVSS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] , [2] , [3] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| von Willebrand factor | Inhibitor | Thrombotic thrombocytopenic purpura [ICD-11: 3B64.14] | N.A. | Ablynx | [1] , [2] , [3] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT01020383 | Click to show the Detail | |||||
| Indication | Unstable Angina; Non ST Segment Elevation Myocardial Infarction (NSTEMI); Stable Angina (Associated With High Risk PCI) | |||||
| Phase | Phase II | |||||
| Title | Comparative Study of ALX-0081 Versus GPIIb/IIIa Inhibitor in High Risk Percutaneous Coronary Intervention (PCI) Patients | |||||
| Status | Completed | |||||
| Sponsor | Ablynx | |||||
| NCT01151423 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase II | |||||
| Title | Study to Assess Efficacy and Safety of Anti-von Willebrand Factor (vWF) Nanobody in Patients With Acquired Thrombotic Thrombocytopenic Purpura (aTTP) | |||||
| Status | Completed | |||||
| Sponsor | Ablynx | |||||
| NCT02189733 | Click to show the Detail | |||||
| Indication | Healthy | |||||
| Phase | Phase I | |||||
| Title | Bioequivalence of Liquid and Reconstituted Lyophilized Subcutaneous Formulations of Caplacizumab | |||||
| Status | Completed | |||||
| Sponsor | Ablynx | |||||
| NCT02553317 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase III | |||||
| Title | Phase III Trial With Caplacizumab in Patients With Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Status | Completed | |||||
| Sponsor | Ablynx | |||||
| NCT02878603 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase III | |||||
| Title | Follow-up Study for Patients Who Completed Study ALX0681-C301 (Post-HERCULES) | |||||
| Status | Completed | |||||
| Sponsor | Sanofi | |||||
| NCT03172208 | Click to show the Detail | |||||
| Indication | Healthy | |||||
| Phase | Phase I | |||||
| Title | Caplacizumab Single and Multiple Dose Study in Healthy Japanese and White Subjects | |||||
| Status | Completed | |||||
| Sponsor | Ablynx | |||||
| NCT04074187 | Click to show the Detail | |||||
| Indication | Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase II; Phase III | |||||
| Title | A Trial of Caplacizumab in Japanese Patients With Acquired Thrombotic Thrombocytopenic Purpura (aTTP) | |||||
| Status | Completed | |||||
| Sponsor | Sanofi | |||||
| NCT04720261 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase II | |||||
| Title | Efficacy of a Personalized Caplacizumab Regimen Based on ADAMTS13 Activity Monitoring in Adult aTTP | |||||
| Status | Not Recruiting | |||||
| Sponsor | University Hospital, Rouen | |||||
| NCT04985318 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Observational | |||||
| Title | Retrospective Analysis of the Efficiency of Caplacizumab in the Treatment of aTTP | |||||
| Status | Recruiting | |||||
| Sponsor | University of Cologne | |||||
| NCT05263193 | Click to show the Detail | |||||
| Indication | Immune-mediated Thrombocytopenic Purpura | |||||
| Phase | Observational | |||||
| Title | Retrospective Study on Caplacizumab-treated Pediatric Patients With Immune-mediated Thrombocytopenic Purpura (iTTP) | |||||
| Status | Completed | |||||
| Sponsor | Sanofi | |||||
| NCT05468320 | Click to show the Detail | |||||
| Indication | Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Phase III | |||||
| Title | Caplacizumab and Immunosuppressive Therapy Without Firstline Therapeutic Plasma Exchange in Adults With Immune-mediated Thrombotic Thrombocytopenic Purpura | |||||
| Status | Recruiting | |||||
| Sponsor | Sanofi | |||||
| NCT05876221 | Click to show the Detail | |||||
| Indication | Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Phase | Observational | |||||
| Title | Platelet Response to Caplacizumab in the Treatment of Acquired Thrombotic Thrombocytopenic Purpura | |||||
| Status | Recruiting | |||||
| Sponsor | University of Cologne | |||||
| References |
|---|