Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003104) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-CHL1 C12
|
|||||
| Synonyms |
scFv C12
|
|||||
| Molecular Weight | 24.7 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli TG1 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 237 | |||||
| SBP Sequence |
>scFv anti-CHL1 C12
EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGY ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGKHSSRPWGQGTLVTVSRGGGS GGGSGGGSSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNN RPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVLG |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Neural cell adhesion molecule L1-like protein | Binder | Tools for promoting neurite outgrowth of hippocampal and cerebellar neurons in vitro | Kd: 1930 nM | University of Hamburg | [1] | |