Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003084) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-CSPG4 UC10
|
|||||
Synonyms |
scFv UC10
|
|||||
Molecular Weight | 26.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 251 | |||||
SBP Sequence |
>scFv anti-CSPG4 UC10
EVQLVESGAEVKKPGDSLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSETSY SPAFQGDVTISVDKSISTAYLQWNSLKASDTGIYYCARRRGNYYMDVWGNGTLVTVSSLK SGGGGSGGGGSGGGGSRSTQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQH PGKAPKLMIYDVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRHV FGTGTQLTVLG |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | scFv 1H10 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Chondroitin sulfate proteoglycan 4 | Binder | Cancers [ICD-11: 2D4Z] | Kd: 9.3 nM | Duke University | [1] | |