Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001768)
SBP Name
scFv anti-L1 5F7
Synonyms
scFv 5F7
Molecular Weight 25.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli HB2151
Selection Method Phage display
Highest Status Research
Sequence Length 240
SBP Sequence
>scFv anti-L1 5F7
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVADISQDSSEKYY
VDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARNAGHRYSTWGQGTLVTVSRGGG
GSGGGGSGGGGSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYG
KNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRTPSGSAVVFGGGTKLTVLG
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name scFv G6
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Neural cell adhesion molecule L1
BTS Info
Binder Tools for various biological assays Kd: 28.6 nM University of Hamburg [1]
References
1 Generation of affinity matured scFv antibodies against mouse neural cell adhesion molecule L1 by phage display. Biochem Biophys Res Commun. 2003 Jan 31;301(1):60-70.