Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001753) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-fluorescein T0
|
|||||
Synonyms |
scFv T0
|
|||||
Molecular Weight | 27.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 251 | |||||
SBP Sequence |
>scFv anti-fluorescein T0
DIQMIQSPSSLSASVGDRVTITCRASQSLVRSQGNTYLRWYQQKPGKAPKVLIYKVSNRS SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTHVPWTFGQGTKVELKRATPSHNS HQVPSAGGPTANGSEVQLVESGGGLVQPGGSLRLSCAASGFTLSDYWMNWVRQAPGKGLE WVGQIRNKPYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLREDTAVYYCTGSYYGMDY WGQGTLVTVSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | scFv 4D5Flu | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Fluorescein | Binder | Tools as a reagent with well folding and stable | Kd: 16 nM | Biochemical Institute of the University of Zurich | [1] | |