Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001752) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-fluorescein G1
|
|||||
| Synonyms |
scFv G1
|
|||||
| Molecular Weight | 27.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 251 | |||||
| SBP Sequence |
>scFv anti-fluorescein G1
DIQMIQSPSSLSASVGDRVTITCRASQSLVRSQGNTYLRWYQQKPGKAPKVLIYKVSNRV SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSTHVPWTFGQGTKVELKRATPSHNS HQVPSAGGPTANGSEVQLVESGGGLVQPGGSQRLSCAASGFTFSGYWMNWVRQAPGKGLE WVAQIRNKPYNYETYYADSVKGRFTISRDTSKNTVYLQMNSLREDTAVYYCTGSYYGMDY WGQGTLVTVSS |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | scFv 4D5Flu | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Fluorescein | Binder | Tools as a reagent with well folding and stable | Kd: 3.9 nM | Biochemical Institute of the University of Zurich | [1] | |