General Information of Synthetic Binding Protein (SBP) (ID: SBP001741)
SBP Name
scFv anti-FMDV AM-32
Synonyms
scFv AM-32
Molecular Weight 29.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli MG1655
Selection Method Fluorescence-activated cell sorting
Highest Status Research
Sequence Length 272
SBP Sequence
>scFv anti-FMDV AM-32
EVQLLESGGGLVQPGGSLRLSCAASGFTYSNYGISWVRQAPGKSLEWVSSIYLNDSSTNY
ADSVKGRFTFSRDNSKNTLYLQMNSLRAEDTAVYYCARLRGATNAFDYWGQGTLVTVSSG
GGGSGGGGSGGGGSEIVLTQSPGTLSLSPGERATLSCRAQNYNWYQQKPGQAPRLMIYST
SRLATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQGVASGVVTFGQGTKEEIKRCLG
GRIRGRVDHHHHHHGAAEQELISEEDLNGRAA
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name scFv #138
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1] , [2]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Genome polyprotein
BTS Info
Binder Foot and mouth disease [ICD-11: 1F05.3] Kd: 42.7 nM Department of Chemical and Biomolecular Engineering [1] , [2]
References
1 Development of high-affinity single chain Fv against foot-and-mouth disease virus. Enzyme Microb Technol. 2016 Mar;84:50-5.
2 Selection for improved protein stability by phage display. J Mol Biol. 1999 Nov 19;294(1):163-80.